PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AHYPO_021978-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Amaranthaceae; Amaranthus
Family HD-ZIP
Protein Properties Length: 749aa    MW: 83010.8 Da    PI: 5.8161
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AHYPO_021978-RAgenomeBYUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox61.99.9e-2057112156
                      TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
         Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                      r++ +++t++q++eLe++F+++ +p++++r ++ ++lgL+ rqVk+WFqNrR++ k
  AHYPO_021978-RA  57 RKRYHRHTPQQIQELENFFKNCAHPDEKQRLDIGRRLGLESRQVKFWFQNRRTQLK 112
                      789999**********************************************9987 PP

2START153.32e-482654853204
                      HHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS........SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEEE CS
            START   3 aeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.......dsgealrasgvvdmvlallveellddkeqWdetla....kaet 81 
                      a +a++el+++a+ ++p+W+k      e++n +e+l+kf  s++       + ++a++++g v+ +  +lv +++d + +W+ +++    ka+ 
  AHYPO_021978-RA 265 AMAAMDELLALAQTDSPLWFKGLddgkEMLNHEEYLKKF--SGFmgmkqcgFITDASKETGSVFITGLELVDTMMDPG-RWQDMFPcvisKAAA 355
                      5689***********************************..556789**999****************9999999999.*************** PP

                      EEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEEEEEE CS
            START  82 levissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvtwve 168
                      +e i+sg      g+l   +ae  ++splvp R   ++R+++q+++g w++vdvSvd  ++p+ s s+++ ++lpSg++i++++ng+s vtw+e
  AHYPO_021978-RA 356 VELICSGtcgthdGELRMLNAEIIFPSPLVPfRQEKILRFCKQHSEGMWAVVDVSVDMIREPSFSGSSIKWRRLPSGCIIQDVANGYSLVTWIE 449
                      **************************************************************99****************************** PP

                      -EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXX CS
            START 169 hvdlkgrlphwllrslvksglaegaktwvatlqrqc 204
                      hv+++++ +h+l+r+l++sg+a+ga++w+atlqr +
  AHYPO_021978-RA 450 HVEYDENCIHQLYRPLLRSGRAFGAQKWLATLQRER 485
                      *********************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.84E-1843113IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.4E-1943116IPR009057Homeodomain-like
PROSITE profilePS5007117.28154114IPR001356Homeobox domain
SMARTSM003891.2E-1755118IPR001356Homeobox domain
PfamPF000462.6E-1757112IPR001356Homeobox domain
CDDcd000861.83E-1661115No hitNo description
PROSITE profilePS5084837.59254490IPR002913START domain
SuperFamilySSF559612.33E-24256483No hitNo description
SMARTSM002343.6E-29263487IPR002913START domain
PfamPF018523.1E-41265485IPR002913START domain
CDDcd088757.85E-87270483No hitNo description
SuperFamilySSF559616.46E-11507684No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0008289Molecular Functionlipid binding
Sequence ? help Back to Top
Protein Sequence    Length: 749 aa     Download sequence    Send to blast
MEGQEEMGFY GEHFDPNNFM GGEKEDSGSD NYDTVSVEDL PEGPSQNKNN KNKDKRRKRY  60
HRHTPQQIQE LENFFKNCAH PDEKQRLDIG RRLGLESRQV KFWFQNRRTQ LKSQMERHEN  120
VVLKQEYDRL RHENIALKDA IRNPMCQNCG GPNILGEISM EQNHLRVENV RLKDELSRVC  180
TLAEKFLGKP ITNYVGPISI LAPNSSLELS MGRGGLNGLM GPPSPLPMGI GPNLENGVSN  240
TSTLTTCMNG SVISEYEKTM FMQAAMAAMD ELLALAQTDS PLWFKGLDDG KEMLNHEEYL  300
KKFSGFMGMK QCGFITDASK ETGSVFITGL ELVDTMMDPG RWQDMFPCVI SKAAAVELIC  360
SGTCGTHDGE LRMLNAEIIF PSPLVPFRQE KILRFCKQHS EGMWAVVDVS VDMIREPSFS  420
GSSIKWRRLP SGCIIQDVAN GYSLVTWIEH VEYDENCIHQ LYRPLLRSGR AFGAQKWLAT  480
LQRERDCAAV FMSARIFPDD ATVGVVTPEG RKSILKLMRR LSNNLCSGLC ASSACRWEKL  540
QVGGLASDVC VMSRVGLNEP GEPAGVVLSA STSVWMPVSR QHLFDILRDE KLRGQWDILA  600
NNGPMEVIAR LSKSHDGNNC VSLLCPPAAP AKESNMLILQ ESWTDRTGSF LVYAPVDSTS  660
IESVLRGGDS DYLVLLPSGF AIADAPMLSN VPSLANDNSN GGACALTLGF QILVNNLLNA  720
KLTVESINTV NDLMSCTVQK IKDSLGVN*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010693469.10.0PREDICTED: homeobox-leucine zipper protein HDG1-like isoform X1
RefseqXP_010693471.10.0PREDICTED: homeobox-leucine zipper protein HDG1-like isoform X3
SwissprotQ9M2E80.0HDG1_ARATH; Homeobox-leucine zipper protein HDG1
TrEMBLA0A0J8BGB90.0A0A0J8BGB9_BETVU; Uncharacterized protein
STRINGPOPTR_0014s07130.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61150.10.0homeodomain GLABROUS 1